PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID NNU_000937-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Proteales; Nelumbonaceae; Nelumbo
Family WRKY
Protein Properties Length: 311aa    MW: 34269.8 Da    PI: 6.8519
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
NNU_000937-RAgenomeCASView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY104.84.7e-33171228259
                    --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
           WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                    +Dgy+WrKYGqK vk+s+fprsYYrCt ++C+vkk+vers+edp++v++tYeg+H h+
  NNU_000937-RA 171 EDGYRWRKYGQKAVKNSPFPRSYYRCTNSKCTVKKRVERSSEDPSIVITTYEGQHCHH 228
                    8******************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.806.6E-34155229IPR003657WRKY domain
SuperFamilySSF1182901.7E-28162228IPR003657WRKY domain
PROSITE profilePS5081129.712165230IPR003657WRKY domain
SMARTSM007749.3E-39170229IPR003657WRKY domain
PfamPF031065.1E-26171228IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009414Biological Processresponse to water deprivation
GO:0009651Biological Processresponse to salt stress
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 311 aa     Download sequence    Send to blast
MDDDEKKHEP GTSFTCTSGW TLGSEADSDY FFGSDRESSI LSEFGWNLRP DTDRNLESES  60
FSPFYQIDLD GCSDLAGTSI PHIPQNTPPP PPAAAPGSSQ TVSAGSVDKS GDASPSNPSV  120
SSSSTDEPQE KSTASEEKPP ETPIKNRKKG QKRTRQPRFA FMTKSEIDHL EDGYRWRKYG  180
QKAVKNSPFP RSYYRCTNSK CTVKKRVERS SEDPSIVITT YEGQHCHHTV GFPRSSFMAH  240
EAAFGAPQLY YPRVHLPLGA SIDVRQPHRG LSGTGQLPLQ PQLQAPRPTS LQLSTDEGLL  300
GDIVPAGMRH R
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2lex_A1e-25160227774Probable WRKY transcription factor 4
1wj2_A1e-25160227774Probable WRKY transcription factor 4
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00067PBMTransfer from AT1G69310Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010259222.10.0PREDICTED: probable WRKY transcription factor 57
SwissprotQ9C9836e-75WRK57_ARATH; Probable WRKY transcription factor 57
TrEMBLF6HF791e-105F6HF79_VITVI; Putative uncharacterized protein
STRINGVIT_01s0011g00720.t011e-104(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69310.29e-69WRKY DNA-binding protein 57